PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.5KG554500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 730aa    MW: 78727.7 Da    PI: 10.0769
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.5KG554500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.6e-2190145156
                          TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
             Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                          r++ +++t+eq++++e++F+++++p++++r++L+++lgL+ rqVk+WFqNrR++ k
  Pavir.5KG554500.1.p  90 RKSYHRHTAEQIKAMEAVFKESPHPDEKQRQQLSQELGLSARQVKFWFQNRRTQIK 145
                          788999**********************************************9877 PP

2START170.79.6e-543065299206
                          HHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS............SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EE CS
                START   9 elvkkalaeepgWvkss....esengdevlqkfeeskv...........dsgealrasgvvdmvlallveellddkeqWdetla....ka 79 
                          el ++ +a+ep+Wv+s     + +n+de+ ++f++++             s+ea+r++gvv+ ++++lv+ ++d + qW e ++    ka
  Pavir.5KG554500.1.p 306 ELTAMCSAGEPLWVRSLetgrDVLNYDEYARRFQRGGDdpagggeqragWSVEASRETGVVFLDTTQLVNAFMDAN-QWMELFPtmisKA 394
                          788999***************************88777**************************************.99999999999** PP

                          EEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCE CS
                START  80 etlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksngh 161
                          +tl+vi+ g      g++qlm+ae q l+plvp R+  f+R++++l+a++w++vdvSvd+ ++    ss   ++ + pSg++ie+  ng+
  Pavir.5KG554500.1.p 395 ATLAVIRAGqnddkdGVVQLMFAEVQTLTPLVPtRELSFLRHCKKLTADKWAVVDVSVDNVEPDARtSSTASKCLKKPSGCVIEEQTNGR 484
                          *************************************************************9999889999******************* PP

                          EEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                START 162 skvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                          +kvtwveh+ ++ + ++++ r+   sgl +ga++wva+l+ qce+
  Pavir.5KG554500.1.p 485 CKVTWVEHATCRNAAVPSMCRPAAASGLTFGARRWVAALRLQCER 529
                          *******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-2376141IPR009057Homeodomain-like
SuperFamilySSF466894.18E-2082151IPR009057Homeodomain-like
PROSITE profilePS5007118.17287147IPR001356Homeobox domain
SMARTSM003895.5E-1989151IPR001356Homeobox domain
CDDcd000865.40E-1890148No hitNo description
PfamPF000461.2E-1890145IPR001356Homeobox domain
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
SMARTSM002346.1E-37299529IPR002913START domain
PROSITE profilePS5084834.356304532IPR002913START domain
SuperFamilySSF559613.85E-25305529No hitNo description
CDDcd088751.09E-88306528No hitNo description
PfamPF018528.6E-43306529IPR002913START domain
Gene3DG3DSA:3.30.530.204.7E-5352498IPR023393START-like domain
SuperFamilySSF559613.48E-7551640No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 730 aa     Download sequence    Send to blast
MGSSSRPPPR TQDFFPAPAL SLSLAGGFGR NEPAASGGEE VDAGDEGGGG IRLRPGEAAE  60
ISSENTAAGS QQSGGEEAAG HGDGGDNKRR KSYHRHTAEQ IKAMEAVFKE SPHPDEKQRQ  120
QLSQELGLSA RQVKFWFQNR RTQIKATQER HENALLKSEL EKLQGENRAM RELAKKSPRC  180
PGCGAAAAAS TEEQQLRLEN AMLKAEVRSR APRHHVATSF LALCAWLQIN TDTHTVTVDG  240
EYTVPCHSGG EAARDPGNPC RRRARRRRPG LAVAAPASPS RSARAIRIGC GGGGGLSGHD  300
RTRILELTAM CSAGEPLWVR SLETGRDVLN YDEYARRFQR GGDDPAGGGE QRAGWSVEAS  360
RETGVVFLDT TQLVNAFMDA NQWMELFPTM ISKAATLAVI RAGQNDDKDG VVQLMFAEVQ  420
TLTPLVPTRE LSFLRHCKKL TADKWAVVDV SVDNVEPDAR TSSTASKCLK KPSGCVIEEQ  480
TNGRCKVTWV EHATCRNAAV PSMCRPAAAS GLTFGARRWV AALRLQCERM VFSVATNIPA  540
RDSAGVATLA GRRSVLKLAH RMASSLCRVI GGSRGLAWSG QASNSGGVRV TSRRNAGDDP  600
GEPCGLVACA VLSAWLPVNP AALLDFLRDA SRRHEWDVML PPGRPVRSRV SVAKGKDRGN  660
CVTAYVDLIS SLTERSRPIM SHHQSHCRSL SDVRPRESRT ASGSSRTAAP APASRPWRTR  720
RSTPRPCGR*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankPNIAATA7e-86D25322.1 Panicum miliaceum gene for cytosolic aspartate aminotransferase, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012701492.10.0PREDICTED: homeobox-leucine zipper protein ROC9
SwissprotQ5JMF30.0ROC9_ORYSJ; Homeobox-leucine zipper protein ROC9
TrEMBLK3XSK50.0K3XSK5_SETIT; Uncharacterized protein
STRINGSi004904m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79840.11e-120HD-ZIP family protein